PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E04108.1.p
Common NameEUGRSUZ_E04108, LOC104445739
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 739aa    MW: 81384.1 Da    PI: 5.8554
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E04108.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.18.5e-2071126156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       r++ +++t+ q++eLe++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Eucgr.E04108.1.p  71 RKRYHRHTQRQIQELEAFFKESPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 126
                       789999***********************************************998 PP

2START213.29.1e-672574781206
                       HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
             START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                       ela +a++el+++a+ +ep+W         e++n+de+ ++f+++ +     +++ea+r+s+vv+m++ +lve+l+d   qW+  +     +a
  Eucgr.E04108.1.p 257 ELAVAAMEELIRMAQGGEPLWIPAGsgqpsEILNEDEYFRIFPRGIGpkplgFKSEASRESAVVIMNHINLVEILMDEH-QWSGVFCgivsRA 348
                       57899****************988888999**************999********************************.******99999** PP

                       EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEE CS
             START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvt 165
                       +t+ev+s+g      galq+m+ae+q++splvp R+ +fvRy++q+g+g+w++vdvS+d+ + +p    + R++++pSg+li++++ng+skvt
  Eucgr.E04108.1.p 349 MTIEVLSTGvagnynGALQVMTAEFQVPSPLVPsRENYFVRYCKQHGDGTWAVVDVSLDNIRGNP----ILRSRRRPSGCLIQELPNGYSKVT 437
                       ****************************************************************9....6*********************** PP

                       EEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 166 wvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       wvehv++++r +h+++r+lv+ gla+gak+wvatl+rqce+
  Eucgr.E04108.1.p 438 WVEHVEVDDRAVHSIYRPLVNCGLAFGAKRWVATLDRQCER 478
                       ***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.52E-2053128IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.9E-2253126IPR009057Homeodomain-like
PROSITE profilePS5007117.91268128IPR001356Homeobox domain
SMARTSM003892.2E-1869132IPR001356Homeobox domain
CDDcd000861.12E-1870129No hitNo description
PfamPF000462.3E-1771126IPR001356Homeobox domain
PROSITE patternPS000270103126IPR017970Homeobox, conserved site
PROSITE profilePS5084845.627248481IPR002913START domain
SuperFamilySSF559611.21E-35250480No hitNo description
CDDcd088758.07E-128252477No hitNo description
SMARTSM002341.1E-66257478IPR002913START domain
PfamPF018526.6E-56258478IPR002913START domain
Gene3DG3DSA:3.30.530.201.3E-6358476IPR023393START-like domain
SuperFamilySSF559612.5E-24497730No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 739 aa     Download sequence    Send to blast
MFQPNMFDSH HHLLDITGAR SSESEVLKMR EIEDFETKSG TETMEPDPSG DDVQDPNNDD  60
NSNNNGQRQK RKRYHRHTQR QIQELEAFFK ESPHPDDKQR KELSRELGLE PLQVKFWFQN  120
KRTQMKAQHE RHENAILKAE NEKLRAENMR YREALSTATC PNCGGPAALG EMSFDEQHLR  180
IENARLKEEI DRISVIASKY VGKPLASNYP HLPPHMSSRS PDQFPAQSGL VGEMYGGIDL  240
RRSVSMPSEA DKPLIVELAV AAMEELIRMA QGGEPLWIPA GSGQPSEILN EDEYFRIFPR  300
GIGPKPLGFK SEASRESAVV IMNHINLVEI LMDEHQWSGV FCGIVSRAMT IEVLSTGVAG  360
NYNGALQVMT AEFQVPSPLV PSRENYFVRY CKQHGDGTWA VVDVSLDNIR GNPILRSRRR  420
PSGCLIQELP NGYSKVTWVE HVEVDDRAVH SIYRPLVNCG LAFGAKRWVA TLDRQCERLA  480
SSMAINIPSG DLLITSPEGR RSMLKLAERM VLSFCSGVGA STAHAWTTLS AAGSDNNVRV  540
MTRKSMDEPG RPPGIVLSAA TSFWLPVPPK RVFDFLRDEN SRNEWDILSN GGQVQEMAHI  600
ANGRDPGNSV SLLRVNNANS SQSNMLILQE SCTDSVGAYV IYAPVDIVAM NVVLNGGDPD  660
YVALLPSGFA ILPDGPEFGG GGGILEIGSG GSLLTVAFQI LVDTVPSAKL SLGSVATVNN  720
LIKCTVERIK ASVSCDNP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E04108.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010057969.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A059CAG50.0A0A059CAG5_EUCGR; Uncharacterized protein
STRINGVIT_10s0116g00680.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2